PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10013830
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family MYB
Protein Properties Length: 341aa    MW: 38312.6 Da    PI: 8.2586
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10013830genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding52.79.7e-171462148
                     TSSS-HHHHHHHHHHHHHTTTT.-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGgg.tWktIartmgkgRtlkqcksrwqkyl 48
                     +g+W++eEd +l+d+++q G+g +W + +++ g++R++k+c++rw++yl
      Lus10013830 14 KGPWSPEEDAKLKDYIHQNGTGgNWISLPQKAGLKRCGKSCRLRWLNYL 62
                     79*********************************************97 PP

2Myb_DNA-binding38.82.2e-1269111246
                      SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      g +T +Ed ++  +++  G++ W+ Ia+ ++ gRt++++k++w++
      Lus10013830  69 GEFTDDEDRIICTLFANIGSR-WSIIAAQLP-GRTDNDIKNYWNT 111
                      78*******************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129414.303962IPR017930Myb domain
SuperFamilySSF466897.26E-2611109IPR009057Homeodomain-like
SMARTSM007171.5E-111364IPR001005SANT/Myb domain
PfamPF002492.9E-151462IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.607.2E-241569IPR009057Homeodomain-like
CDDcd001679.29E-91662No hitNo description
PROSITE profilePS5129421.95563117IPR017930Myb domain
SMARTSM007171.4E-1167115IPR001005SANT/Myb domain
PfamPF002495.2E-1169111IPR001005SANT/Myb domain
CDDcd001672.47E-870113No hitNo description
Gene3DG3DSA:1.10.10.602.7E-2370117IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 341 aa     Download sequence    Send to blast
MGRAPCCDKA NVKKGPWSPE EDAKLKDYIH QNGTGGNWIS LPQKAGLKRC GKSCRLRWLN  60
YLRPNIKHGE FTDDEDRIIC TLFANIGSRW SIIAAQLPGR TDNDIKNYWN TKLKKKLMGT  120
LLPTNSSSSS YRKLPFHPHH LANYASILQS SPLSNSVLTS SNSSLSVDHP SSSHSTNPFK  180
SNHNNYGLIR PMIANDQLTC SNNSCSFNSA MQQHYQVKDR VFMFGGATEA SCSSSDGSSN  240
NVLQHQANKE FDYENEQQQQ QHQQLFKMGG YSQQGSVISS TNFTDYISST GFCNQMTMNS  300
PNNLEDYGLE EIKQLVSTCN NNNNLLLFDD NRKEERVMFY *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A8e-25141177108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006381399.11e-102hypothetical protein POPTR_0006s12530g
TrEMBLU5GA631e-102U5GA63_POPTR; Uncharacterized protein
STRINGPOPTR_0006s12530.11e-101(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF13034340
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G57620.18e-70myb domain protein 36